Protein Info for Shew_3001 in Shewanella loihica PV-4

Annotation: extracellular solute-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 725 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 37 to 64 (28 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 215 to 240 (26 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 294 to 320 (27 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 376 to 396 (21 residues), see Phobius details amino acids 408 to 433 (26 residues), see Phobius details PF00375: SDF" amino acids 15 to 390 (376 residues), 142.7 bits, see alignment E=1.7e-45 PF00497: SBP_bac_3" amino acids 483 to 702 (220 residues), 73.6 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_3001)

Predicted SEED Role

"Proton/glutamate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHB9 at UniProt or InterPro

Protein Sequence (725 amino acids)

>Shew_3001 extracellular solute-binding protein (RefSeq) (Shewanella loihica PV-4)
MTLVLKKLLAMTSSTQMLVAMFVGFAVGLFFGESVGWMSSIGTSVILLMQMTVLPYILVS
LVGGIGKLKRATASLIFSRAGVIMLLLWAVGLLLVALMPLSFPFVETASFFSTSSIEPAT
AIDYFKLYIPSNPFQSMAEGYVPAMVIFAIAMGLALIGMEGDNKQLIINFMHTCSEIFSK
ITQALVKVLPIGIFAMSASAAGTMGVDEFASMQVYLISYFVLCLLLTFWVLPWIVASLTP
VTFAQALRISKSSLVTAFATGNIFIVIPVIVEECKQIMREHQSLSDDAETLVEILVPIAF
TFPNIGKLTVILFVLFAGWFNGTPIELSALPSLSISGVLSLFGSVYVAIPFMLDLVHLPQ
DLFQLFVMSGFITGKFNSITAVMNLFALTLLTVALFEKRLRLRPPQLLKMAIGVGASVVL
TLIVCRVGMGLFIHSPEVTSGVIANMQVADKVPTKVSKQYPVLGQSASRPIADVNAIRAR
GLLRVGYIPSNVPFSYYNNAGQLVGFDSAMANRLADDLGVKVEFIPFEKDKLAASLDAGF
FDIAMSGLAMDIEQMDKLNYVEPVLLLNLAIATKDHKVNSFKRNQSIKAMQDTTIAYVEH
SDIIEDAKAFYPNLKFVKIKGYKDFFRQKGDKYDALVISAEAGSAWTLFFPGYGIAPLEY
KAKYPIAYAVAQDNQSLLNYVNNWQKLRKVDGHQERLYNYWMLGQGASEPKPRWSIIRDV
LHWVD