Protein Info for Shew_2994 in Shewanella loihica PV-4

Annotation: CopY family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 PF03965: Penicillinase_R" amino acids 4 to 117 (114 residues), 119.7 bits, see alignment E=4.3e-39

Best Hits

Swiss-Prot: 32% identical to BLAI_STAES: Penicillinase repressor (blaI) from Staphylococcus epidermidis (strain ATCC 12228)

KEGG orthology group: K07737, putative transcriptional regulator (inferred from 100% identity to slo:Shew_2994)

Predicted SEED Role

"Beta-lactamase repressor BlaI" in subsystem Beta-lactamase or Methicillin resistance in Staphylococci or Tn552

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHB2 at UniProt or InterPro

Protein Sequence (124 amino acids)

>Shew_2994 CopY family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MKEISNAELSVLNILWQDSPLGASEVVEALTSSKDMHEKTVKTLLNRLVKKQALGFEKQG
RAYRYFPLIDQSEYQLKESQSFVERVFAGKVAPLVAGFAKQKQLSPEDIAELKALIDNWE
EEQS