Protein Info for Shew_2985 in Shewanella loihica PV-4

Annotation: Sel1 domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 22 to 22 (1 residues), see Phobius details PF08238: Sel1" amino acids 69 to 102 (34 residues), 12.1 bits, see alignment (E = 1.3e-05) amino acids 146 to 176 (31 residues), 20 bits, see alignment (E = 4.2e-08) amino acids 214 to 240 (27 residues), 12.1 bits, see alignment (E = 1.3e-05) amino acids 249 to 277 (29 residues), 17.7 bits, see alignment (E = 2.3e-07) amino acids 320 to 350 (31 residues), 16.5 bits, see alignment (E = 5.3e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2985)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QHA3 at UniProt or InterPro

Protein Sequence (504 amino acids)

>Shew_2985 Sel1 domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MQVVIFSVILALLFISLLLVYLNWRSKQPIEVTGGPDEVIFLANQLLHSGREAQALDYLE
RAAAMGMAHAAQFLGELYSLDDHHLYDLDKANHWFQQAGELDEQFAQIQRQMLKLKLHPS
QKGGSHELEAMLKPGADQGNSQHQGELGRLYQESPLLDPDGSKALHYLELAAEAGDAEAQ
YHLAKVLLEPRHGEPDPIRARALLTAIADSDPLAKSQLAQMLLRGEGGPADPREAERLMR
EEAEDNEFALIELAHLYQEGKHLPKDIDKAEECLRQAMAMENNSATYLLGELLLKHKRAN
DSHLEAITLLTPLAQQWMTDALFLLGQAHEEGLGTRRHLPTALAYYRLAAIDPAPYHLER
VETLSAKMGSYEKEQAESLYQAFLTEHPIEKSQQACIDLTHGLRLLHEDDKGKRHPREAI
SFLERAALAGENLAFKPLHKACAELSQRVDAAVWAQIALEDQFYFLPTGEMESSLASLKQ
GFSESEQALFEQRLQERREALTGH