Protein Info for Shew_2979 in Shewanella loihica PV-4

Annotation: putative iron-sulfur cluster binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 TIGR00276: epoxyqueuosine reductase" amino acids 19 to 361 (343 residues), 491.6 bits, see alignment E=5.3e-152 PF08331: QueG_DUF1730" amino acids 67 to 150 (84 residues), 78.1 bits, see alignment E=3.8e-26 PF13484: Fer4_16" amino acids 203 to 266 (64 residues), 76 bits, see alignment E=3.1e-25

Best Hits

Swiss-Prot: 79% identical to QUEG_SHEON: Epoxyqueuosine reductase (queG) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2979)

MetaCyc: 68% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

"Epoxyqueuosine (oQ) reductase QueG"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH97 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Shew_2979 putative iron-sulfur cluster binding protein (RefSeq) (Shewanella loihica PV-4)
MSDHSPLSPQALQQLALKIKTWGKALGFAQIGICDTDLRAEEPKFQAWLDKGYHGEMGYM
ESHGMMRARPQELHPGTVRVISARMDYLPPEAGFATHLKDPNLAYISRYAGGRDYHKMIR
NRLKKLGQQIEAELETLGLERPNYRPFVDSAPILERPLADKAGLGWTGKHSLLLNHEAGS
WFFLGELLIDLPLPVDIPVQADCNTCVACIKSCPTNAIVEPYVVDGRRCISYLTIELQGA
IPEEFRPLMGNRIYGCDDCQLVCPVNGEAPLTQESDFHTRDPLKHPELLTLFAWNEAEFL
KFTEGSAIRRIGHKRWLRNIAIALGNAPASQEIIAALEARRESDEVDEMVREHIDWALTR
QRLGDYQANRKTQRVIRTVEKGLPRDA