Protein Info for Shew_2966 in Shewanella loihica PV-4

Annotation: membrane-flanked domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 transmembrane" amino acids 18 to 41 (24 residues), see Phobius details PF03703: bPH_2" amino acids 58 to 129 (72 residues), 57.5 bits, see alignment E=1.3e-19 PF24649: DUF7642" amino acids 71 to 138 (68 residues), 30 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: K08981, putative membrane protein (inferred from 100% identity to slo:Shew_2966)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH84 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Shew_2966 membrane-flanked domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MEEKTLLEARFHHKLGHYWLTSGAVVLAVSVVGIPLLLLWYPIGLWATHRYIANMSAELT
TKKLIVRKGILTRTENTVPLEKITDMAMIQGPLMRLFGIHKLTIETAGQSGNGALISLTG
VEEVAEFRAAVMAQKSALAEQSQPVEAKVDVAAQTLACLQSIDQTLRRIDAKLAQS