Protein Info for Shew_2965 in Shewanella loihica PV-4

Annotation: putative manganese transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 94 to 120 (27 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 334 to 352 (19 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details PF01566: Nramp" amino acids 42 to 367 (326 residues), 47.1 bits, see alignment E=9.1e-17

Best Hits

Swiss-Prot: 49% identical to Y681_PASMU: Uncharacterized protein PM0681 (PM0681) from Pasteurella multocida (strain Pm70)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2965)

Predicted SEED Role

"FIG01059484: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH83 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Shew_2965 putative manganese transporter (RefSeq) (Shewanella loihica PV-4)
MENVSVNTTQTSLWLQCRRLLTATGPGLLMAAAAIGASHLVASTRAGAEFGWQLAWVILL
VNLLKYPFFAAGARYTAATGESLLHGYQRQGRGYLLLFSLLNALAAVASTAGVAMLTAAL
LTQFIPLPIDLLALIVLVASLLLLVLGHYRVLDRVTKVIMLCLTVTTLSAAALAFNAEPI
LAPGFVSPSPWQWAHVGFLVAMMGWMPAPIEVSCWNSLWLLEKQKQQRVTPKQALFDFNL
GFITTAILAVVFLSLGAMVMHGSGVHFSPSGAKFAEQLIQLYSQVLGEGSRYLIALVALL
CIFSTTVTVVDGYSRTLILSVQLLRKDEVSERGLNLTMLAVSLLGLGIILFFKGALLPLL
QFVMTLAFMTTIIFAWLNYRLMTSDNLAPGDRYGVAMRLLSWIGMTYLLGFAALFVYWKF
VG