Protein Info for Shew_2963 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF07308: DUF1456" amino acids 3 to 70 (68 residues), 92.4 bits, see alignment E=8.3e-31 amino acids 86 to 153 (68 residues), 98.7 bits, see alignment E=8.9e-33

Best Hits

Swiss-Prot: 42% identical to YEHS_ECOLI: Uncharacterized protein YehS (yehS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2963)

Predicted SEED Role

"FIG01058638: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH81 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Shew_2963 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MINNDILRRLRFVFDYKNAKMIKIFAKVKHEMSQEVLLNMLKKEAEEGYKPCNDKTLCLF
LDGLIIEKRGLRDGAEIPAPVSQLNNNLIFKKLRIALEMREEDIIETLALADFRMTSSEL
GALFRKPGHKHFKECGDQVLRNFLMGLSIKYRGK