Protein Info for Shew_2926 in Shewanella loihica PV-4

Annotation: CBS domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF21917: NMB0537_N" amino acids 26 to 61 (36 residues), 39.6 bits, see alignment 5e-14 PF00571: CBS" amino acids 66 to 122 (57 residues), 32 bits, see alignment E=1.9e-11 amino acids 137 to 187 (51 residues), 33.1 bits, see alignment 8.5e-12 PF03471: CorC_HlyC" amino acids 206 to 281 (76 residues), 72.5 bits, see alignment E=3.5e-24

Best Hits

Swiss-Prot: 61% identical to CORC_SHIFL: Magnesium and cobalt efflux protein CorC (corC) from Shigella flexneri

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 100% identity to slo:Shew_2926)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH44 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Shew_2926 CBS domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MSDDNPPSSNAHKKGWFEKVSQLFQGEPQSRDELVEVIHDAEQREVISEDTREMIKGVLE
VSDLRVRDIMIPRAQIVALKIDNTVEELLSTVIGSAHSRFPVVNEDKDHIEGILLAKDLL
QYGFKNNDEPFSLEQVIRPAVVVPESKRVDVLLKEFRSQRYHMAIVVDEYGGVSGLVTIE
DILEEIVGEIEDEFDHDSAEETEIRKVGKQIYMVKALTPIDDFNETFGTQFSDEEFDTVG
GLVSHAFGHLPERNEKITIDEIEFKVISADTRRLVQLRVKLPDPQTEEENA