Protein Info for Shew_2919 in Shewanella loihica PV-4

Annotation: translation-associated GTPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR00092: GTP-binding protein YchF" amino acids 1 to 363 (363 residues), 559.3 bits, see alignment E=2e-172 PF02421: FeoB_N" amino acids 5 to 45 (41 residues), 32.5 bits, see alignment 9.2e-12 PF01926: MMR_HSR1" amino acids 5 to 113 (109 residues), 74.6 bits, see alignment E=1.1e-24 PF06071: YchF-GTPase_C" amino acids 279 to 362 (84 residues), 132.2 bits, see alignment E=9.3e-43

Best Hits

Swiss-Prot: 80% identical to YCHF_PASMU: Ribosome-binding ATPase YchF (ychF) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K06942, (no description) (inferred from 100% identity to slo:Shew_2919)

MetaCyc: 80% identical to redox-responsive ATPase YchF (Escherichia coli K-12 substr. MG1655)
Nucleoside-triphosphatase. [EC: 3.6.1.15, 3.6.1.5]

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15 or 3.6.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH37 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Shew_2919 translation-associated GTPase (RefSeq) (Shewanella loihica PV-4)
MGFKCGIVGLPNVGKSTLFNALTKAGIEASNFPFCTIEPNTGVVPVPDPRLEALAEIVKP
ERVLPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFEDENIVHVANKVS
PASDIEVINTELALADLDSCERAILRQQKRAKGGDKDAKFEVSVLEKMRPVLDEGHMLRS
MDLSKEELAAVNYLNFLTLKPTMYIANVAEDGFENNPHLDAVREIAAKENAVVVAVCAAI
ESELAEMDPEDRDEFMADLGLEEPGLDRVIRAGYQLLDLHTYFTAGVKEVRAWTVPVGAC
APQAAGVIHTDFERGFIRAQVMSYDDFIAYKGEAGAKEAGKLRVEGKTYVVKDGDVMHFL
FNV