Protein Info for Shew_2915 in Shewanella loihica PV-4

Annotation: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase" amino acids 6 to 278 (273 residues), 302.6 bits, see alignment E=1.8e-94 PF00288: GHMP_kinases_N" amino acids 70 to 147 (78 residues), 68.2 bits, see alignment E=6e-23 PF08544: GHMP_kinases_C" amino acids 199 to 262 (64 residues), 44.7 bits, see alignment E=1.4e-15

Best Hits

Swiss-Prot: 100% identical to ISPE_SHELP: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 100% identity to slo:Shew_2915)

MetaCyc: 56% identical to 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (Escherichia coli K-12 substr. MG1655)
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase. [EC: 2.7.1.148]

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH33 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Shew_2915 4-diphosphocytidyl-2C-methyl-D-erythritol kinase (RefSeq) (Shewanella loihica PV-4)
MTSNRSTAWPAPAKLNLFLHVNGRRADGYHELQTLFQFIDYCDYLDFAVNDSGSLTLHSE
MEAVVANSDNLILKAAKSLQEYTGTHQGAEIWLDKKLPMGGGIGGGSSDAATTLVALNHL
WQTQLSQDELAKIGLSLGADVPVFINGLAAFAEGVGEKLIPVEAPENWYLILTPDVHVST
AEVFNDPLLPRDTPKLSMDDLMSSDWHNDCQPRVAERYPQVAKALAWLIEYAPSRMTGTG
ACVFGIFDTRQQAEHVFAKLPAGLCGFIAKGTNKSPLALRLTQH