Protein Info for Shew_2901 in Shewanella loihica PV-4

Annotation: phosphoesterase, PA-phosphatase related (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details transmembrane" amino acids 61 to 79 (19 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details PF01569: PAP2" amino acids 88 to 214 (127 residues), 48.2 bits, see alignment E=4.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2901)

Predicted SEED Role

"PHOSPHATIDYLGLYCEROPHOSPHATASE B (EC 3.1.3.27)" (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH19 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Shew_2901 phosphoesterase, PA-phosphatase related (RefSeq) (Shewanella loihica PV-4)
MHNSMLKHLFPGSAKGALLLYGLLLTLVLISVHLIDRQLADLMHAQQLSHPALKLLSKTP
LLLEFLAGLTIFACISARFRARFQALAIELVLTLALAFSIRWIAKLLFGRTWPESWISLG
NGHNPSWVADRIEAFHPFAQGFAYDSFPSGHALLTFALAFTFWRHTPKLMPLWLGCMFAV
ITGQLSLNYHYLGDLLAGASFGLLASQLALTLYRALKGRMASLT