Protein Info for Shew_2887 in Shewanella loihica PV-4

Annotation: sterol desaturase family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 75 (24 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 92 to 226 (135 residues), 112 bits, see alignment E=1.5e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2887)

Predicted SEED Role

"Sterol desaturase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH05 at UniProt or InterPro

Protein Sequence (304 amino acids)

>Shew_2887 sterol desaturase family protein (RefSeq) (Shewanella loihica PV-4)
MDFNSLIAHPEVLLLVLAPLFFVCILAEWYFGDRRGRLPDNARYHLPEVLCNFTLAGLHQ
GADILTGLLIAKLYLWAFDWRLLDIQMGLGSFIALIIAQDFCYYWFHRASHRVRWMWAAH
VAHHSSERMNFSTAFRQSLMYPFAGMWIFWLPLVVVGFDPNWVVFAVLLNLGLQFFVHTQ
AIKTLGPLEWVFNTPSHHRVHHGRNPQYIDKNYAGVLIIWDRLFGTYVKEEETVEYGITK
PVNSFNPLVVTFSEWKAMFSEAFSPGLSLKQRLALMFAPPAAPEPQDKIADADADAEPER
KLAS