Protein Info for Shew_2886 in Shewanella loihica PV-4

Annotation: rRNA (guanine-N(2)-)-methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF26049: RLMG_N" amino acids 3 to 183 (181 residues), 197.1 bits, see alignment E=8.5e-62 PF05175: MTS" amino acids 203 to 379 (177 residues), 164.4 bits, see alignment E=6.5e-52 PF03602: Cons_hypoth95" amino acids 231 to 327 (97 residues), 26 bits, see alignment E=2.4e-09 PF06325: PrmA" amino acids 233 to 314 (82 residues), 30.3 bits, see alignment E=1.1e-10 PF10294: Methyltransf_16" amino acids 234 to 313 (80 residues), 24 bits, see alignment E=1.1e-08 PF13847: Methyltransf_31" amino acids 235 to 284 (50 residues), 32.4 bits, see alignment 2.7e-11 PF13649: Methyltransf_25" amino acids 236 to 343 (108 residues), 31.3 bits, see alignment E=9.3e-11

Best Hits

Swiss-Prot: 100% identical to RLMG_SHELP: Ribosomal RNA large subunit methyltransferase G (rlmG) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to slo:Shew_2886)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QH04 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Shew_2886 rRNA (guanine-N(2)-)-methyltransferase (RefSeq) (Shewanella loihica PV-4)
MTTQFSVADIELSLSRYPANQVSNLQAWDAADEHLIKHLKEIEQKADNTAVINDSFGALC
AALTAQAADWPIWVETDAKTSQLGTLQNFNANRLSDSNLTWLNSRELPPQGINLVLMKLP
KNLNYFIHQLQRLSQSLAPNTPVYIGAKAKSINKALLETIAKHLGPASASLAWKKTRVIT
CIADGKPRALPSEVSWAVKEFNLSISNLSNVFAANKLDIGARIMLDNLPEGHFDTIVDLG
CGNGILGLRAKQCYPNAEVHFVDDSEMAITSARQNWQANKLDNPEQAKPQGHFHWDDCLT
HLGDEVKPDLVLCNPPFHQGEAITDHIAWQMFLDAFHQLRPGGMLQVVGNRHLGYHVKLK
RIFKNCETAASNGKFVILRAIKSAKEPVKPAKDVNEPDHQS