Protein Info for Shew_2886 in Shewanella loihica PV-4

Annotation: rRNA (guanine-N(2)-)-methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05175: MTS
  • amino acids 203 to 379 (177 residues), 172.5 bits, E=2e-54
• PF03602: Cons_hypoth95
  • amino acids 231 to 327 (97 residues), 25.4 bits, E=3e-09
• PF06325: PrmA
  • amino acids 233 to 314 (82 residues), 29.9 bits, E=1.2e-10
• PF10294: Methyltransf_16
  • amino acids 234 to 313 (80 residues), 24 bits, E=9.2e-09
• PF13847: Methyltransf_31
  • amino acids 235 to 283 (49 residues), 34.1 bits, 6.7e-12
• PF13649: Methyltransf_25
  • amino acids 236 to 343 (108 residues), 31.3 bits, E=8.3e-11

Best Hits

Swiss-Prot: 100% identical to RLMG_SHELP: Ribosomal RNA large subunit methyltransferase G (rlmG) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 100% identity to slo:Shew_2886)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Sequence Analysis Tools

See A3QH04 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Shew_2886 rRNA (guanine-N(2)-)-methyltransferase (RefSeq) (Shewanella loihica PV-4)
MTTQFSVADIELSLSRYPANQVSNLQAWDAADEHLIKHLKEIEQKADNTAVINDSFGALC
AALTAQAADWPIWVETDAKTSQLGTLQNFNANRLSDSNLTWLNSRELPPQGINLVLMKLP
KNLNYFIHQLQRLSQSLAPNTPVYIGAKAKSINKALLETIAKHLGPASASLAWKKTRVIT
CIADGKPRALPSEVSWAVKEFNLSISNLSNVFAANKLDIGARIMLDNLPEGHFDTIVDLG
CGNGILGLRAKQCYPNAEVHFVDDSEMAITSARQNWQANKLDNPEQAKPQGHFHWDDCLT
HLGDEVKPDLVLCNPPFHQGEAITDHIAWQMFLDAFHQLRPGGMLQVVGNRHLGYHVKLK
RIFKNCETAASNGKFVILRAIKSAKEPVKPAKDVNEPDHQS