Protein Info for Shew_2876 in Shewanella loihica PV-4

Annotation: Na(+)-translocating NADH-quinone reductase subunit F (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details TIGR01941: NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit" amino acids 11 to 415 (405 residues), 773.3 bits, see alignment E=2.5e-237 PF00111: Fer2" amino acids 53 to 122 (70 residues), 36.7 bits, see alignment E=5e-13 PF00970: FAD_binding_6" amino acids 205 to 274 (70 residues), 39.1 bits, see alignment E=1.2e-13 PF00175: NAD_binding_1" amino acids 285 to 393 (109 residues), 63.5 bits, see alignment E=4e-21

Best Hits

Swiss-Prot: 93% identical to NQRF_SHEDO: Na(+)-translocating NADH-quinone reductase subunit F (nqrF) from Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

KEGG orthology group: K00351, Na+-transporting NADH:ubiquinone oxidoreductase subunit F [EC: 1.6.5.-] (inferred from 100% identity to slo:Shew_2876)

MetaCyc: 85% identical to Na(+)-translocating NADH-quinone reductase subunit F (Vibrio cholerae)
TRANS-RXN-214 [EC: 7.2.1.1]

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit F (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.- or 7.2.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGZ4 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Shew_2876 Na(+)-translocating NADH-quinone reductase subunit F (RefSeq) (Shewanella loihica PV-4)
MGIIESTPIDVYLGVSMFTAIVLVLVLVILFAKSKLVPSGDITIGINHDADKAIKTPAGG
KLLGALASNGIFVSSACGGGGSCGQCKVIVKSGGGDILPTELDHISKGDARNGCRLSCQV
NVKSDMEIELEEEIFGIKKWECSVISNDNKATFIKELKLAIPDGESVPFRAGGYIQIEAP
AHHVKYADFDVPAEYRGDWEHFGFFKLESKVDEETIRAYSMANYPEEEGIIMLNVRIATP
PPRNLSLPCGKMSSYIWSLKAGDKVTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIF
DQLKRLKSKRKMSFWYGARSKREMFYVEDFDGLAAENDNFVWHVALSDPQPEDNWDGYTG
FIHNVLYENYLRDHDAPEDCEFYMCGPPMMNAAVIGMLKDLGVEDENILLDDFGG