Protein Info for Shew_2871 in Shewanella loihica PV-4

Annotation: DNA polymerase IV (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF00817: IMS" amino acids 7 to 154 (148 residues), 177.6 bits, see alignment E=3e-56 PF11798: IMS_HHH" amino acids 166 to 197 (32 residues), 29.8 bits, see alignment (E = 9e-11) PF21999: IMS_HHH_1" amino acids 180 to 230 (51 residues), 45.9 bits, see alignment 1.2e-15 PF11799: IMS_C" amino acids 240 to 336 (97 residues), 47.9 bits, see alignment E=3.3e-16

Best Hits

Swiss-Prot: 100% identical to DPO4_SHELP: DNA polymerase IV (dinB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 100% identity to slo:Shew_2871)

MetaCyc: 64% identical to DNA polymerase IV (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]; 2.7.7.7 [EC: 2.7.7.7]

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGY9 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Shew_2871 DNA polymerase IV (RefSeq) (Shewanella loihica PV-4)
MKKIIHVDMDCFFAAVEMRDFPELRGKPIAVGGRSDRRGVISTCNYEARKFGVRSAMASA
YALKLCPDLILVPGRMSVYKEVSAQIREVFARYTELIEPLSLDEAYLDVSDCTQHQGSAT
LIAEAIRREIFEVTGLTASAGIAPVKFLAKIASDLNKPNGQYVITPQMIPEFVKTLALIK
IPGVGKVTAAKLETMGLITCADVQACSRQSLMERFGKFGGVLYDRAQGIDPRGISPHRER
KSVGVETTLAKDIYTYEQCQAVMPQLIQELSGRISRSAKSRRIHKQVVKLKFDDFKQTTI
EQRSDEVSVKLFYDLLKQALERRAGRGIRLLGVSVGLESEAVGAGLDEEVHGAQMDLGF