Protein Info for Shew_2863 in Shewanella loihica PV-4

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 8 to 194 (187 residues), 169.5 bits, E=9.7e-54
• PF08659: KR
  • amino acids 10 to 161 (152 residues), 30.7 bits, E=4.3e-11
• PF13561: adh_short_C2
  • amino acids 14 to 246 (233 residues), 199.8 bits, E=7.9e-63

Best Hits

Swiss-Prot: 39% identical to UCPA_SALTI: Oxidoreductase UcpA (ucpA) from Salmonella typhi

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2863)

MetaCyc: 39% identical to oxidoreductase UcpA (Escherichia coli K-12 substr. MG1655)
RXN-11032 [EC: 1.1.1.304]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase"

MetaCyc Pathways

• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• superpathway of 2,3-butanediol biosynthesis (3/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.304

Sequence Analysis Tools

See A3QGY1 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Shew_2863 short-chain dehydrogenase/reductase SDR (RefSeq) (Shewanella loihica PV-4)
MQSNFEGKVVLITGAASGFGKLLAQRLAPQGAKLVLGDINDTALDALCSELGECAVGLRC
DVSIEAEQLALAQLAEESFGRLDIAINNAGISAPMKSLLATTEADMDLSFAINTKGVFFG
MKAQIPLMQKHKCGAILNVASMAGINGAPKLTPYVAAKHAVVGITRTAALEFAAQGIQVN
AICPFFTPTPMVTEGVDPALIEQLTRAVPMRRLADPNEVVSAMLHMVNPDNGFMTGQAIA
IDGGVSAI