Protein Info for Shew_2863 in Shewanella loihica PV-4

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00106: adh_short" amino acids 8 to 194 (187 residues), 169.5 bits, see alignment E=9.7e-54 PF08659: KR" amino acids 10 to 161 (152 residues), 30.7 bits, see alignment E=4.3e-11 PF13561: adh_short_C2" amino acids 14 to 246 (233 residues), 199.8 bits, see alignment E=7.9e-63

Best Hits

Swiss-Prot: 39% identical to UCPA_SALTI: Oxidoreductase UcpA (ucpA) from Salmonella typhi

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2863)

MetaCyc: 39% identical to oxidoreductase UcpA (Escherichia coli K-12 substr. MG1655)
RXN-11032 [EC: 1.1.1.304]

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.304

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGY1 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Shew_2863 short-chain dehydrogenase/reductase SDR (RefSeq) (Shewanella loihica PV-4)
MQSNFEGKVVLITGAASGFGKLLAQRLAPQGAKLVLGDINDTALDALCSELGECAVGLRC
DVSIEAEQLALAQLAEESFGRLDIAINNAGISAPMKSLLATTEADMDLSFAINTKGVFFG
MKAQIPLMQKHKCGAILNVASMAGINGAPKLTPYVAAKHAVVGITRTAALEFAAQGIQVN
AICPFFTPTPMVTEGVDPALIEQLTRAVPMRRLADPNEVVSAMLHMVNPDNGFMTGQAIA
IDGGVSAI