Protein Info for Shew_2861 in Shewanella loihica PV-4

Annotation: aminoglycoside phosphotransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 289 to 308 (20 residues), see Phobius details PF01636: APH" amino acids 30 to 249 (220 residues), 184.3 bits, see alignment E=3.4e-58 PF02958: EcKL" amino acids 168 to 243 (76 residues), 30.1 bits, see alignment E=3.3e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2861)

Predicted SEED Role

"Aminoglycoside phosphotransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGX9 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Shew_2861 aminoglycoside phosphotransferase (RefSeq) (Shewanella loihica PV-4)
MSRAVENLDLDTLQPYLEAHVAGFKGPMQVEKFAGGQSNPTFKLTTASGTYVLRRQPPGK
LLKSAHAVDREYRVLKALADTDVPVAKVYHLCEDTGIIGSMFYLMEYCEGRIYWDAALPE
VGREERGQLYDEMNRVLAALHNVDIDKVGLSDYGRPGNYFQRQFDRWSSQYRASQTDHIE
AMEALMTWLGNNIPEDDGRVSLVHGDYRLDNLMFHPTEPKAVALLDWELSTLGHPFADLG
YLCMQMRMPAIGTVSGLRGKDLAELGIPDEQAYVNSYCQRTGIDKIDNFGFYIAFSFFRL
AAIIQGVAKRAIDGNASNKNAAELGQHVGPLAEMAQEAIADQIKE