Protein Info for Shew_2825 in Shewanella loihica PV-4

Annotation: tRNA pseudouridine synthase B (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 TIGR00431: tRNA pseudouridine(55) synthase" amino acids 10 to 218 (209 residues), 282.3 bits, see alignment E=1.2e-88 PF01509: TruB_N" amino acids 32 to 179 (148 residues), 193 bits, see alignment E=5.8e-61 PF16198: TruB_C_2" amino acids 180 to 247 (68 residues), 77.2 bits, see alignment E=1.3e-25 PF09157: TruB-C_2" amino acids 252 to 308 (57 residues), 64.4 bits, see alignment E=1.1e-21

Best Hits

Swiss-Prot: 100% identical to TRUB_SHELP: tRNA pseudouridine synthase B (truB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03177, tRNA pseudouridine synthase B [EC: 5.4.99.12] (inferred from 100% identity to slo:Shew_2825)

MetaCyc: 64% identical to tRNA pseudouridine55 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11839 [EC: 5.4.99.25]

Predicted SEED Role

"tRNA pseudouridine synthase B (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12 or 5.4.99.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGU3 at UniProt or InterPro

Protein Sequence (315 amino acids)

>Shew_2825 tRNA pseudouridine synthase B (RefSeq) (Shewanella loihica PV-4)
MARKPRGRLVDGIVLLDKDTGMSSNFALQRVKRIYNAAKAGHTGALDPLATGMLPICLGE
ATKFSQHLLDADKRYLVTAKLGVRTDTSDSDGEVVQTRPINFTEQQLEEALEHFRGETMQ
VPSMYSALKYQGQPLYKYAREGKEVPREARPIKVFELNFIKLEGDELTLDIHCSKGTYIR
TITDDLGEMLGCGAHVIMLRRTGVAGYPYDKMVTLEQLEALLAKAQEEERPPKELLDPLL
LPMDTAVSGLKEINVSDELAHYLMNGNPVQVANLPIDELVRITLGEAKQFVGIGQMNDDG
LLAPKRLVVLHDEQA