Protein Info for Shew_2823 in Shewanella loihica PV-4

Annotation: diguanylate cyclase/phosphodiesterase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 677 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 244 to 407 (164 residues), 143.3 bits, see alignment E=2.9e-46 PF00990: GGDEF" amino acids 248 to 405 (158 residues), 162.5 bits, see alignment E=7.6e-52 PF00563: EAL" amino acids 426 to 656 (231 residues), 228.4 bits, see alignment E=8e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2823)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGU1 at UniProt or InterPro

Protein Sequence (677 amino acids)

>Shew_2823 diguanylate cyclase/phosphodiesterase (RefSeq) (Shewanella loihica PV-4)
MSARFKSLTWKQTTLVVFSALFFAVAIFIVEVALVGVSARQQLMVAQEELLDSIEQPAAN
AVWALDDNLATQTLEGVLKVEHVGEAVIELDDGSMFVSMNNPFTDNPLVRKLSEKLFGDL
KQISRTLYRPSFFEGTEKQQIIGTLTIFYNTQELTDSLFSQLRFSFLATLARALLVTMAL
SIIFHRFLTKPIAQISEAIDKIDPELPDENLLPTSTAHQDDELGLVTSKFNQILIQFGQT
QSKLRRMATRDPLTGLPNRTLLLETIAVSIQRARVHKHQFTMLFIDLDRFKNVNDSLGHA
LGDQFLARIARVLERVVGDRGTVARLGGDEFVILAEDARTPDQAADFVDKLLMQLNVPLQ
LNEHTIHPAASVGISIYPDDGLSAEDLIRHADIAMYSAKAAGSNQWAFFKQQMTERAAVR
LRTEASLHDALKNNEFLLHFQPKFNIKTGKVIACEALIRWKKDGRLISPMSFIPVAEETG
IIIPLGRWVIEEACRTLKHWRKRYNYAIPIAVNVASQQFADASLVPDIKQLALRYQIDPS
LLEVEITETSLMNDIELAIHKLEQLKGAGFGIAVDDFGTGYSSLSYLRHLPITTMKIDRC
FVTDLPNESAIASTILMLGKQLNLHIVAEGIENEQQLNWLKQMDCEIGQGFYYSQPLDIS
EFENRYIAPNNASISQI