Protein Info for Shew_2820 in Shewanella loihica PV-4

Name: prfC
Annotation: peptide chain release factor 3 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 TIGR00503: peptide chain release factor 3" amino acids 2 to 525 (524 residues), 972.4 bits, see alignment E=4.7e-297 PF00009: GTP_EFTU" amino acids 10 to 274 (265 residues), 157 bits, see alignment E=1.3e-49 TIGR00231: small GTP-binding protein domain" amino acids 12 to 151 (140 residues), 56.3 bits, see alignment E=3.3e-19 PF22042: EF-G_D2" amino acids 292 to 378 (87 residues), 91.3 bits, see alignment E=1.1e-29 PF03144: GTP_EFTU_D2" amino acids 311 to 377 (67 residues), 36.8 bits, see alignment E=1.3e-12 PF16658: RF3_C" amino acids 384 to 510 (127 residues), 154.5 bits, see alignment E=4.1e-49 PF14492: EFG_III" amino acids 394 to 459 (66 residues), 27.9 bits, see alignment E=5.9e-10

Best Hits

Swiss-Prot: 100% identical to RF3_SHELP: Peptide chain release factor 3 (prfC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 100% identity to slo:Shew_2820)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGT8 at UniProt or InterPro

Protein Sequence (526 amino acids)

>Shew_2820 peptide chain release factor 3 (RefSeq) (Shewanella loihica PV-4)
MSGYTVEVDKRRTFAIISHPDAGKTTITEKVLLFGQALQKAGTVKGKKSGQHAKSDWMEM
EKDRGISITTSVMQFPYREALVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDSAKGVEQR
TIKLMEVTRLRDTPIVTFMNKLDRDIRDPIELMDEVENILNIACAPITWPIGAGKEFKGV
YHLLRDEVILYQNGMGHTIQDSRVIKGLDNPELDEAIGSYAQDLRDEMELVLGASHEFDL
EAFLKGELTPVFFGTALGNFGVDHILDGIVEWAPRPQPRESDQRNVEPDESKFSGFVFKI
QANMDPKHRDRVAFMRVCSGRYEQGMKMHHVRIGKDVNVSDALTFMAGDRNRAEAAYPGD
IIGLHNHGTIRIGDTFTQGEKLRFTGVPNFAPEMFRRIRLKDPLKQKQLLKGLVQLSEEG
AVQVFRPLDSNDLIVGAVGVLQFEVVVQRLKSEYKVEAIYEAISVATARWVYSKDAKKLE
EFKRKCSNNLALDGGDNLTYVAPTMVNLNLSMERYPDIEFAKTREN