Protein Info for Shew_2815 in Shewanella loihica PV-4

Annotation: deoxyribose-phosphate aldolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF01791: DeoC" amino acids 11 to 240 (230 residues), 152.7 bits, see alignment E=6.4e-49 TIGR00126: deoxyribose-phosphate aldolase" amino acids 12 to 226 (215 residues), 249.6 bits, see alignment E=1.1e-78

Best Hits

Swiss-Prot: 100% identical to DEOC_SHELP: Deoxyribose-phosphate aldolase (deoC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to slo:Shew_2815)

MetaCyc: 72% identical to deoxyribose-phosphate aldolase (Escherichia coli K-12 substr. MG1655)
Deoxyribose-phosphate aldolase. [EC: 4.1.2.4]

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGT3 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Shew_2815 deoxyribose-phosphate aldolase (RefSeq) (Shewanella loihica PV-4)
MSDLKKAAQKAIELMDLTTLNDDDTDQKVIELCHKAKTPAGNTAAICIYPRFIPIARKTL
NEMGCEEIKIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMEGNETVGYE
LVKACKEACGDDVLLKVIIESGVLQDPALIRKASELSIDAGADFIKTSTGKVEVNATLEA
AEIMMTVIAEKNPKVGFKPAGGVRDAAAAEEFLGVAERLLGKGWATPRTFRFGASSLLNN
LLHTLELAEAPKGPQGY