Protein Info for Shew_2803 in Shewanella loihica PV-4

Annotation: DNA-binding transcriptional regulator TorR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00072: Response_reg" amino acids 10 to 118 (109 residues), 108 bits, see alignment E=3.1e-35 PF00486: Trans_reg_C" amino acids 166 to 235 (70 residues), 71.7 bits, see alignment E=4.2e-24

Best Hits

KEGG orthology group: K07772, two-component system, OmpR family, torCAD operon response regulator TorR (inferred from 100% identity to slo:Shew_2803)

Predicted SEED Role

"TorCAD operon transcriptional regulatory protein TorR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGS1 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Shew_2803 DNA-binding transcriptional regulator TorR (RefSeq) (Shewanella loihica PV-4)
MALTSLQPCVLVVDDEAVIRARLKGYFEKEGYRVLEAADGEEMWQQFSQQHIDLVMLDIN
LPGVDGLSLTRELRSRSEVGIILVTGRDEAIDKIIGLEMGADDYVTKPFELRELLVRVKN
LLWRISLVKKAQQQAIAELERCDDLIEFEDYSLALNSRRLSQGEAVIKLTKAEFELLSAF
VLHPQQVLSRERLMQLTSHRNQDVNDRTIDVIIRRLRNKLHAELFVTVHGEGYLFSAKVE
D