Protein Info for Shew_2793 in Shewanella loihica PV-4

Annotation: succinyl-diaminopimelate desuccinylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR01246: succinyl-diaminopimelate desuccinylase" amino acids 2 to 374 (373 residues), 396.2 bits, see alignment E=7e-123 PF01546: Peptidase_M20" amino acids 58 to 373 (316 residues), 131.3 bits, see alignment E=4.7e-42 PF07687: M20_dimer" amino acids 171 to 272 (102 residues), 81 bits, see alignment E=6.1e-27

Best Hits

Swiss-Prot: 100% identical to DAPE2_SHELP: Succinyl-diaminopimelate desuccinylase 2 (dapE2) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2793)

Predicted SEED Role

"N-succinyl-L,L-diaminopimelate desuccinylase (EC 3.5.1.18)" in subsystem Arginine Biosynthesis extended or Lysine Biosynthesis DAP Pathway (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.18

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGR1 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Shew_2793 succinyl-diaminopimelate desuccinylase (RefSeq) (Shewanella loihica PV-4)
MRYCRELMRRPSITPEDAGCQQWLGERLVAMGFDVSHYQDKGVSNLLASFDERPAQLALA
GHTDVVPPGDLSRWQTPPFAATLVDGMLIGRGAVDMKSGLAVMLAAVEDHIACYGLPKAN
WQFIVTSDEEGEAEHGTRTLVERLKAQSRLPKYCVVAEPTADKQAGDVIKIGRRGAISAR
LTLKGKQGHVAYPKNAVNALHMAARVMQALEALIWDEGSDDFPGTSLQVTHVDSGAFTDN
IVPGSCEICFNIRYSYRYSEAGIMARIQACLDGLSLGEDAISLRWERGCQPYHTQENDEQ
SLIAQVEAAIFEVTASFPRLSTSGGTSDGRFLSSPQTQVIELGLPNRTIHQVNERVELAQ
IVRLYRIYRALLTRFHD