Protein Info for Shew_2786 in Shewanella loihica PV-4

Annotation: sterol-binding domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 PF02036: SCP2" amino acids 43 to 135 (93 residues), 64.9 bits, see alignment E=3.8e-22

Best Hits

Swiss-Prot: 45% identical to YHBT_ECOLI: SCP2 domain-containing protein YhbT (yhbT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2786)

Predicted SEED Role

"FIG138517: Putative lipid carrier protein" in subsystem CBSS-214092.1.peg.3450

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGQ4 at UniProt or InterPro

Protein Sequence (170 amino acids)

>Shew_2786 sterol-binding domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MQRSVLANMAKHLLQYGPKVIAKPLNLVPFSIKAQLIERILNLLMAAQIKDGELDFLQAR
WVKISVTDLELSFEVSFDERLIVREGGEAEVSFSGCSQALLLIAAGKEDPDTLFFQRRLA
IEGDTELGLEVKNLLLSIEFDTMPVFMRQSITQAAAMLTQLQRQANMPWA