Protein Info for Shew_2778 in Shewanella loihica PV-4

Annotation: diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1010 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 35 to 58 (24 residues), see Phobius details amino acids 70 to 97 (28 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 35 to 188 (154 residues), 93.7 bits, see alignment E=4e-30 TIGR00229: PAS domain S-box protein" amino acids 206 to 322 (117 residues), 59.6 bits, see alignment E=3.5e-20 amino acids 326 to 455 (130 residues), 44.5 bits, see alignment E=1.6e-15 amino acids 452 to 574 (123 residues), 60.6 bits, see alignment E=1.7e-20 PF13426: PAS_9" amino acids 215 to 317 (103 residues), 31.3 bits, see alignment E=8.3e-11 amino acids 467 to 569 (103 residues), 50.9 bits, see alignment E=6.7e-17 PF08447: PAS_3" amino acids 227 to 302 (76 residues), 35.4 bits, see alignment 4.4e-12 amino acids 356 to 442 (87 residues), 56.1 bits, see alignment E=1.5e-18 amino acids 478 to 561 (84 residues), 29.2 bits, see alignment E=3.6e-10 PF13188: PAS_8" amino acids 460 to 506 (47 residues), 21.6 bits, see alignment 6.5e-08 PF00989: PAS" amino acids 461 to 562 (102 residues), 39.5 bits, see alignment E=2e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 579 to 741 (163 residues), 160.4 bits, see alignment E=3.3e-51 PF00990: GGDEF" amino acids 581 to 738 (158 residues), 184.3 bits, see alignment E=5.8e-58 PF00563: EAL" amino acids 758 to 994 (237 residues), 256 bits, see alignment E=1.2e-79

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2778)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGP6 at UniProt or InterPro

Protein Sequence (1010 amino acids)

>Shew_2778 diguanylate cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s) (RefSeq) (Shewanella loihica PV-4)
MNQDTLFSLSQNAALLLIMVFIYDAVPRHHRSEYFLLWRLIMGAVIGGVTVLTMMTSWEY
QPGVFIDTRSVVLAISGLFFGGLPTFVAASVACAYRLFQGGDGMLVGVTVILVSALFGSL
WRYYRKTTIADLSFIELYLFGFLLHFSTLSLLFILPFSMFVDLLVQIALPVMLIFPIVTA
LLGMMLARRLEVERDAKIQLQDDFIFRSQFNVGNMGIAITSVDQHWIKVNPRLCKMLKYS
ETELLNRTWTELTYFEDLKADMTQFQRMLKGEIDAYEMDKRFVAKDGEIVYTHLTVACRR
NHNMVDMVIAGLIDITEHKRADMAMRTSQERLALVLESSDLGMWDWDIKSNETKRNPWCA
KVLGCDLERLNRDSRIWIDAIHPQDRMAVLNSIDRHLKGETQKHYIEYRLISLSGEEHWI
LDTGKVVSRDRNGLPTRMCGVHSDITEQKKVQESLELAASVYNNSSEAMSVQDHKGHIIT
INAAFTAITGYSQEEALTQNIRILQSSRTPRSQYDEMNSAIRDTGYWQGELWIKNKSGEE
YMVWLTINTIFDQHGQVYRRVALFSDITEKKEAEHIIWKQANYDPLTGLPNRRMLLEYLN
TEILRIDRNHSHFALMFLDLDFFKEVNDTLGHDMGDLLLQETAKRLKGCIRESDVVARLG
GDEFTVVLSGIDSPSGVERVAQSILERIAEPYSLGDETAYISASIGITIYPDDATSIEGL
LKHADQAMYAAKEQGRNRFHYFTPSMQEYARYRMALIKDLRNAINRKEFELFYQPIVDMN
KLGVYKAEALIRWVHPQRGLVSPGEFIPVAEETGLINEIGNWVFEKAAQQSARWRTQHGV
EIQISINKSPIQFRDEGDTFSDWLALLRHLELSSNAICVEITEGLLLDASMGVTDKLLAY
RDAGIQVSLDDFGTGYSSLAYLKKFDIDYLKIDQSFTRNLESDSDGVALCEAIIVMAHKL
GIKVIAEGVETQFQHDILASAGCDFAQGYLYSKPVSLPEFERLYVNPEAR