Protein Info for Shew_2773 in Shewanella loihica PV-4

Annotation: NAD(+) kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF01513: NAD_kinase" amino acids 8 to 120 (113 residues), 77.5 bits, see alignment E=1.2e-25 PF20143: NAD_kinase_C" amino acids 146 to 271 (126 residues), 137.6 bits, see alignment E=1.9e-44

Best Hits

Swiss-Prot: 100% identical to NADK_SHELP: NAD kinase (nadK) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K00858, NAD+ kinase [EC: 2.7.1.23] (inferred from 100% identity to slo:Shew_2773)

MetaCyc: 57% identical to NAD kinase (Escherichia coli K-12 substr. MG1655)
2.7.1.M29,2.7.1.23 [EC: 2.7.1.23, 2.7.1.M29]

Predicted SEED Role

"NAD kinase (EC 2.7.1.23)" in subsystem NAD and NADP cofactor biosynthesis global (EC 2.7.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.23

Use Curated BLAST to search for 2.7.1.23 or 2.7.1.M29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGP1 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Shew_2773 NAD(+) kinase (RefSeq) (Shewanella loihica PV-4)
MSKAFHSIGLIGKPHHSGTHKTLKRLHHWLTMQSYDVYVEERVAAEIGPQVKSVDLLQIG
EYCDLAIVVGGDGNMLGAARVLARFDIGVIGVNRGNLGFLTDLPPDTFEEALGKVLQGEY
ETEHRFLLESEVHRHGEMKSSNTAVNEAVLHPGKIAHMIEFEVYIDDKFMYSQRADGMIV
STPTGSTAYSLSAGGAILTPNLEALILVPMFPHTLSCRPIVVDACSIIKLVVSPDNGDAL
EVSCDGHVTLPVLPGDEIIVRRSKERLRLIHPKGYNYFHVLRNKLGWGSKLF