Protein Info for Shew_2753 in Shewanella loihica PV-4

Annotation: TPR repeat-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 718 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 474 to 494 (21 residues), see Phobius details PF13424: TPR_12" amino acids 242 to 304 (63 residues), 39.5 bits, see alignment E=2.2e-13 PF14938: SNAP" amino acids 247 to 376 (130 residues), 25.4 bits, see alignment E=3.8e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2753)

Predicted SEED Role

"FIG00920775: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGM1 at UniProt or InterPro

Protein Sequence (718 amino acids)

>Shew_2753 TPR repeat-containing protein (RefSeq) (Shewanella loihica PV-4)
MRVFLYSLLLFFCCATSVNAAFSQLISKEVKFKESAPEFYQDAIASLSFPIEFASEVEFN
HLADTQGFSSQELEQQLQWLARVYLEPGIGVDDAMEKAQQVMTQLEIIADTPYDRAYLLM
LQGRKTGRDKQDYQLAITYYQQALAQLKASEDLPTQLLLHNIHYQLGDLYRITLQKNAAL
THLNQYRELAYQLRDDYLIAKAESTLGHYYSGDEQFAKALQHYTEAIRLAEGLDKPFLNA
ILSLRLARVYRDLKSWDEALTYAHKAADGFTKVGKDNYLSSAMTVIAMVYGEQERWNQAI
DYYLNAQQIDVRRGNLTAQALNLHNLGEAYFNNKEPKRALTNLIKANGLFLQKKSKHYLI
YNDLLIAQVASQLGDWSMVNAYAAKAFVLAREKKLPEQMFEALQYKTRALKELGDIDKAL
AALEQLIALSQDLEHESQKPSDYSPSVLAEQQLKLQLSQLQASNKTQEKQAHQFRLAASI
IFIVSMLLALAGINQWRGKSKLKRQLASLKQKVNQEPITQLPGYHGFIARMRQKNEIAQL
ALLSLDDGHTLDLNLGNDTYLEATARLMDTLSRGLAGEAYLIRPGLILLTLNEVNAHQAL
QERIRSLLDDQPQSQGTHFKLGCIKVPLLGNPDIKVTPDTYFNVLQMLVAGAMSLGTQKD
CYVSITPLNFAPAAILSNPLYLHLEKGISRGLVKVECNENKALIQWPKWQGANDADPT