Protein Info for Shew_2751 in Shewanella loihica PV-4
Name: rdgC
Annotation: recombination associated protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RDGC_SHELP: Recombination-associated protein RdgC (rdgC) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)
KEGG orthology group: K03554, recombination associated protein RdgC (inferred from 100% identity to slo:Shew_2751)Predicted SEED Role
"DNA recombination-dependent growth factor C" in subsystem CBSS-562.2.peg.5158 SK3 including or DNA repair, bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A3QGL9 at UniProt or InterPro
Protein Sequence (303 amino acids)
>Shew_2751 recombination associated protein (RefSeq) (Shewanella loihica PV-4) MWFKNLTVYRFNKPFSVDTEALEKSLEDFTFSPCSSQDISKFGFSKALGKLGHTLVHSAE NRHLICATKEEKILPSQVVKEALEEKVAQIEAEENRKLAKKEKDALKEEITTTLLPRAFS RRSQIHALILPEIEMILVDSSSATKAEELLALLRKALGSLPVIPMSFKTPIEAQLTEWLK SNSAPAPFEMQDEAELKSDSDEGGIVRFKQQDLTENEVLAHLEVGKQVHKLALHFGQSIA FVLQSDAGIKRLKFSEEFRAHNDEVSTEDPLARLDADFALMGSELIALMNSLVEVLGGLE DSL