Protein Info for Shew_2749 in Shewanella loihica PV-4

Annotation: two component transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR02154: phosphate regulon transcriptional regulatory protein PhoB" amino acids 13 to 238 (226 residues), 370.2 bits, see alignment E=1.5e-115 PF00072: Response_reg" amino acids 17 to 129 (113 residues), 106.8 bits, see alignment E=6.9e-35 PF00486: Trans_reg_C" amino acids 163 to 237 (75 residues), 100.2 bits, see alignment E=5.5e-33

Best Hits

Swiss-Prot: 75% identical to PHOB_ECO57: Phosphate regulon transcriptional regulatory protein PhoB (phoB) from Escherichia coli O157:H7

KEGG orthology group: K07657, two-component system, OmpR family, phosphate regulon response regulator PhoB (inferred from 100% identity to slo:Shew_2749)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGL7 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Shew_2749 two component transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MNTWEFTDRRSHMTARILIVEDELAIREMLAFVLEQHGFTTTTAEDFDSALDMLSEPYPD
LVLLDWMFPGGSGIQLAKKLRQDEFTRHIPVIMLTARGEEEDKVKGLEVGADDYITKPFS
PKELVARIKAVMRRAAPTALEEPIDVQGLVLDPVSHRVTVGDQVLEMGPTEFRLLHFFMT
HPERVYSREQLLDNVWGTNVYVEDRTVDVHIRRLRKAVEPSNHDRLIQTVRGAGYRFSTR
L