Protein Info for Shew_2692 in Shewanella loihica PV-4

Annotation: cytochrome B561 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 30 to 248 (219 residues), 106.5 bits, see alignment E=7e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2692)

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGG0 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Shew_2692 cytochrome B561 (RefSeq) (Shewanella loihica PV-4)
MPKEAINQVAANQGAVSHQGVSQEVKVYKVWDTPTRLFHWINLGLVMVLIFIGMVMLFKG
DIGISGLEAKIGLKKLHVWVGYLFAINLSVRLIWGVIGSHSARLSQLLPDLKGLSGYKAK
LAKGESPQYLHHNPMGRLAIFAMMLLLVTIMVTGLVRAGTDIYYPPFGGAVSDYIAQPGV
DGASIKPYDDTGVDAQKVAVLKPYKSLAGEVHVYSVYLLILMIVLHVAGVIVAEIKHQPG
LVSAMISGNKPLSGPAEDEKH