Protein Info for Shew_2642 in Shewanella loihica PV-4

Annotation: flavodoxin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF00258: Flavodoxin_1" amino acids 6 to 140 (135 residues), 97.2 bits, see alignment E=5.3e-32

Best Hits

Swiss-Prot: 46% identical to YQCA_SHIFL: Uncharacterized protein YqcA (yqcA) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2642)

Predicted SEED Role

"Hypothetical flavoprotein YqcA (clustered with tRNA pseudouridine synthase C)" in subsystem Flavodoxin

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QGB0 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Shew_2642 flavodoxin (RefSeq) (Shewanella loihica PV-4)
MRKVNLVYGTVYGNAQFVAETLQEELLAKDIQVTLMTPETLNGFVPPEDELLLVVTSTTG
QGDLPDDISPWFETLRGEAPYLPKLEYGVVALGDSSYETFCFAGIRFDELLTELGGTRIG
ELLKIDACETMEPEVEAKAWLTQWTQLINDHAAD