Protein Info for Shew_2628 in Shewanella loihica PV-4

Annotation: putative membrane-associated zinc metalloprotease (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details amino acids 378 to 401 (24 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details TIGR00054: RIP metalloprotease RseP" amino acids 3 to 453 (451 residues), 436.3 bits, see alignment E=6e-135 PF02163: Peptidase_M50" amino acids 11 to 441 (431 residues), 258.3 bits, see alignment E=1e-80 PF13180: PDZ_2" amino acids 231 to 290 (60 residues), 27.8 bits, see alignment E=4.9e-10 PF17820: PDZ_6" amino acids 231 to 280 (50 residues), 33.3 bits, see alignment 6.7e-12

Best Hits

Swiss-Prot: 52% identical to Y2253_VIBCH: Putative zinc metalloprotease VC_2253 (VC_2253) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K11749, regulator of sigma E protease [EC: 3.4.24.-] (inferred from 100% identity to slo:Shew_2628)

MetaCyc: 52% identical to intramembrane zinc metalloprotease RseP (Escherichia coli K-12 substr. MG1655)
3.4.21.-; RXN-18678

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG96 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Shew_2628 putative membrane-associated zinc metalloprotease (RefSeq) (Shewanella loihica PV-4)
MLDFLWNLGSFIIALGILITAHEYGHFWVARRCGVKVERFSIGFGKAIWRKIGADGTEYV
VAMIPLGGYVKMLDERVDTVADELKPQAFNRKSVWQRIAIVGAGPMANFVFAIFALYIMY
LIGVPSIKPVIESTQSGSPAAVIQVKKPMQVIAVGDRSVRNWEEVTYALVGHIGDDAIDV
TLAPLSGVMGEERTYKLDTRKWKFNPETESPITSLGLNVFRPAITPKLGFVAEDGAAYAA
GLRLGDTLVAVDNKSYGDWDQFVAKIKASADKPISVTIRRDGEQLKFNVTPKARTIDGGK
VEGVIGVAPTQAPWPDEMRLQLEYGVGESLMVAADKTWQLVSVSIKMIGKLFTGDVSVKN
LSGPISIAQGAGNSANYGLVYFLGFLALISVNLGIINLLPLPVLDGGHLLYYFIEVITGR
PVPEKVQEIGFRFGAALLLILMSIALFNDFSRL