Protein Info for Shew_2621 in Shewanella loihica PV-4

Annotation: ribonuclease H (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF01351: RNase_HII" amino acids 21 to 196 (176 residues), 128.1 bits, see alignment E=2.1e-41

Best Hits

Swiss-Prot: 100% identical to RNH2_SHELP: Ribonuclease HII (rnhB) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03470, ribonuclease HII [EC: 3.1.26.4] (inferred from 100% identity to slo:Shew_2621)

MetaCyc: 68% identical to RNase HII (Escherichia coli K-12 substr. MG1655)
Ribonuclease H. [EC: 3.1.26.4]

Predicted SEED Role

"Ribonuclease HII (EC 3.1.26.4)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA replication, archaeal or Ribonuclease H (EC 3.1.26.4)

Isozymes

Compare fitness of predicted isozymes for: 3.1.26.4

Use Curated BLAST to search for 3.1.26.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG89 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Shew_2621 ribonuclease H (RefSeq) (Shewanella loihica PV-4)
MAIYKQITAEQVEALCSGFYAGVDEVGRGPLVGDVVTAAVVLDPNNPIEGLNDSKKLSEK
KRDALYEEILAKALDVSVGRCSPLEIDELNILHATMLAMQRAVAGLRARPDRVLIDGNRV
PDFTDETLEGHAVIKGDGLIPAISAASIVAKVVRDREMEALDERYPEYGFAKHKGYPTKA
HFEALEAHGVLAEHRKSFRPVKERLEAC