Protein Info for Shew_2577 in Shewanella loihica PV-4

Annotation: methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 147 to 167 (21 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details PF13426: PAS_9" amino acids 19 to 107 (89 residues), 32.8 bits, see alignment E=1.4e-11 TIGR00229: PAS domain S-box protein" amino acids 22 to 114 (93 residues), 46.7 bits, see alignment E=1.6e-16 PF00989: PAS" amino acids 23 to 107 (85 residues), 45.9 bits, see alignment E=1e-15 PF08447: PAS_3" amino acids 32 to 114 (83 residues), 60.5 bits, see alignment E=3.2e-20 PF00015: MCPsignal" amino acids 327 to 481 (155 residues), 133.2 bits, see alignment E=1.8e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2577)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG45 at UniProt or InterPro

Protein Sequence (524 amino acids)

>Shew_2577 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor (RefSeq) (Shewanella loihica PV-4)
MRNNQPVIDNEVVLTDDDILLSTTDLKGNIGYANEDFCRICGFSEEELVRQPHNIVRHPD
MPKAAFAILWQRLAQKQSWLGVVKNRCKDGSYYWVNAYVAPVMENGQVKEYQSVRRRASQ
AQVERASDIYQSLNKSEQRSEIKDAKLGYGGKLTLFAVLCLLLAIGLSNISPWLALICAP
LLAIGMRLLLAPLRALNDQALTIVSDPVARHIYAGRRDELGNIQFAMEFTTAEIAGVVGR
MTDASSVIARDSDALLGSITATADRADGQNQQTAQAAAAVEELTASFNELGQQLKQVSAD
VEASQAAVLQGYEQLDAVVASIDELHNEVGNFAQVVSEIEHDSVAINQVLEVITKIAEQT
NLLALNAAIEAARAGESGRGFAVVADEVRQLSARTADSTSQIDAIIAKFQQSTANAANTL
TAGQRQATQAVQLVKQAEAVFAELVTRIDKINQMTELSADAMQEQGLAAVDISDSLQAIS
ELASEGFAQSQADRQLGERSSLKSMESRQLARQFWRQAVHRANA