Protein Info for Shew_2570 in Shewanella loihica PV-4

Annotation: acyl-CoA dehydrogenase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF02771: Acyl-CoA_dh_N" amino acids 14 to 125 (112 residues), 146.9 bits, see alignment E=6.2e-47 PF02770: Acyl-CoA_dh_M" amino acids 129 to 224 (96 residues), 91.3 bits, see alignment E=7.2e-30 PF00441: Acyl-CoA_dh_1" amino acids 236 to 384 (149 residues), 146.1 bits, see alignment E=1.9e-46 PF08028: Acyl-CoA_dh_2" amino acids 257 to 367 (111 residues), 45.7 bits, see alignment E=1.6e-15

Best Hits

Swiss-Prot: 68% identical to IVD_SOLTU: Isovaleryl-CoA dehydrogenase, mitochondrial (IVD) from Solanum tuberosum

KEGG orthology group: K00253, isovaleryl-CoA dehydrogenase [EC: 1.3.99.10] (inferred from 100% identity to slo:Shew_2570)

MetaCyc: 79% identical to isovaleryl-CoA dehydrogenase subunit (Pseudomonas aeruginosa PAO1)
RXN0-2301 [EC: 1.3.8.4]

Predicted SEED Role

"Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)" (EC 1.3.8.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.4 or 1.3.99.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG38 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Shew_2570 acyl-CoA dehydrogenase domain-containing protein (RefSeq) (Shewanella loihica PV-4)
MTQLYSSLNFGLGEDIDMLRDAVRSFAANEIAPIAAKVDQENAFPNELWPVLGEMGLLGV
TVPEEYGGADMGYLAHVVAMEEISRASASIGLSYGAHSNLCVNQINRNGNAEQKAKYLPK
LVSGEHIGALAMSEPNAGSDVVSMKLSARKEGDRYILNGNKMWITNGPDADTYVIYAKTD
MDKGPHGITAFIVERGFKGFSQAQKLDKLGMRGSNTCELVFEDCEVPEENILGGLNNGVK
VLMSGLDYERVVLSGGPLGIMTACMDIVVPYIHEREQFGKSIGQFQLVQGKLADMYTGMN
AAKSYVYNVAKSCDRGETTRKDAAGAILYSAELATKMALDAIQLLGGNGYVNEYATGRLL
RDAKLYEIGAGTSEIRRMLIGRELFNESK