Protein Info for Shew_2558 in Shewanella loihica PV-4

Annotation: 1,4-dihydroxy-2-naphthoate octaprenyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 218 to 248 (31 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details TIGR00751: 1,4-dihydroxy-2-naphthoate octaprenyltransferase" amino acids 9 to 286 (278 residues), 207.3 bits, see alignment E=1.7e-65 PF01040: UbiA" amino acids 17 to 252 (236 residues), 123.5 bits, see alignment E=4.8e-40

Best Hits

KEGG orthology group: K02548, 1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC: 2.5.1.- 2.5.1.74] (inferred from 100% identity to slo:Shew_2558)

Predicted SEED Role

"1,4-dihydroxy-2-naphthoate polyprenyltransferase (EC 2.5.1.74)" (EC 2.5.1.74)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.74

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG26 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Shew_2558 1,4-dihydroxy-2-naphthoate octaprenyltransferase (RefSeq) (Shewanella loihica PV-4)
MNPWILATRPRTLPAAIGPILVGNALALSLTQFSWLIAATSMLCALLLQIAVNLANDYFD
FKSGIDTEERLGPVRVTQSGLLDPSKVRNAMIACLLLALLVGSLLIYHGGWPIAILAAAS
ILGALGYSGGPYPLASHGLGEVAAFIFFGLVAVVGSYYLQAHDTSVAAWILGSAIGLFNA
AVMLVNNTRDIPTDAKAGKRTLAVKIGEGQARVLYQALVYLPFALVIGGFLLGTLPGLPV
LLGGLSLVLARKLNSEFSQTSGAALNPLLGRTAKLTVIFSALFSLGLALA