Protein Info for Shew_2539 in Shewanella loihica PV-4

Annotation: branched-chain amino acid transport (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 68 to 100 (33 residues), see Phobius details PF05437: AzlD" amino acids 3 to 100 (98 residues), 79.8 bits, see alignment E=7.2e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2539)

Predicted SEED Role

"FIG023406: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG07 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Shew_2539 branched-chain amino acid transport (RefSeq) (Shewanella loihica PV-4)
MMIWLTMLAMTAVIFLSRYLFLEPKLPLRLSKNTLQFLGYSAPAVLTAIAAPILFVRDQQ
LAITFDNSYLICGLVAVLLAYFTRNTLLTVLVSMALFFIIH