Protein Info for Shew_2537 in Shewanella loihica PV-4

Annotation: AraC family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF02311: AraC_binding" amino acids 49 to 181 (133 residues), 90.3 bits, see alignment E=1.4e-29 PF12833: HTH_18" amino acids 226 to 303 (78 residues), 74.4 bits, see alignment E=1.1e-24 PF00165: HTH_AraC" amino acids 267 to 301 (35 residues), 38.2 bits, see alignment 1.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2537)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG05 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Shew_2537 AraC family transcriptional regulator (RefSeq) (Shewanella loihica PV-4)
MKSPATESTTKHAADPQRLGRKSAKAQAIAREKQQTKEQANFSLAKELGGIELLDASYHQ
QNFSRHSHEGYTVGVIETGAQRFYRTGGDHTAPQHSIILVNADEVHNGRSATDFGWSYRA
MYPLPQQFARVHDELGGKAGDAPYFPEPVVHDKPLAELLRLTFDTLSSSDNALLRESLIY
TSLARLMSHHGASRPVEKSLRPTAHLALVKQFLDDMPTADVSLDALAKLAGLSPFYLIKQ
FQRQYGLPPHAYQIQGRIRLAKQMIRQGCKLLEVALACGFHDQSHLNRHFKRAMGVTPGQ
YAREVEDCRARG