Protein Info for Shew_2535 in Shewanella loihica PV-4

Annotation: pyridoxal-dependent decarboxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 TIGR03799: putative pyridoxal-dependent aspartate 1-decarboxylase" amino acids 8 to 532 (525 residues), 947.6 bits, see alignment E=7.8e-290 PF00282: Pyridoxal_deC" amino acids 76 to 443 (368 residues), 169.2 bits, see alignment E=1.7e-53 PF01212: Beta_elim_lyase" amino acids 221 to 367 (147 residues), 30.1 bits, see alignment E=4.6e-11 PF00266: Aminotran_5" amino acids 248 to 355 (108 residues), 25.7 bits, see alignment E=8.3e-10

Best Hits

Swiss-Prot: 66% identical to PANP_ALIF1: Aspartate 1-decarboxylase (panP) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2535)

Predicted SEED Role

"Glutamate decarboxylase, eukaryotic type (EC 4.1.1.15)" (EC 4.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QG03 at UniProt or InterPro

Protein Sequence (546 amino acids)

>Shew_2535 pyridoxal-dependent decarboxylase (RefSeq) (Shewanella loihica PV-4)
MTSKQTRQATASEEALMRIFTLPEAPNSTLGKIEKNLSENLMGFLKESIVAVEKPLTEIE
KDFQAYQIPTAPSFVSDYAEQMMQTLIAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHMVYGQTEEFYQSWMHSASHSLGAFCSGGTVANIT
ALWIARNRLLKPDGDFKGVAQSGLMRALRHYGYDDLAILVSTRGHYSLGKAADLLGIGRD
NIISVPCASDNKVDVAKMREAAEQLAEQNIKVMAIVGVAGTTETGNIDPLDELANLAEQL
GCHFHVDAAWGGASLLSSKYRHLLAGIERADSVTIDAHKQMYVPMGAGMVLFKDPEFANA
IKHHAEYILRKGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFGE
LIAAQDDFQLVSRPELCLLTYRYVPAKVQAQLNEAVAAGDAARVSEINALLDGLTKFIQK
RQREQGKSFVSRTRIIPANNLEQTSVVFRVVLANPLTSNEILQQVLDEQRDIAKLDDRFL
PKLLAL