Protein Info for Shew_2527 in Shewanella loihica PV-4

Annotation: outer membrane protein precursor MtrB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03509: decaheme-associated outer membrane protein, MtrB/PioB family" amino acids 57 to 699 (643 residues), 717.9 bits, see alignment E=6.5e-220 PF11854: MtrB_PioB" amino acids 65 to 699 (635 residues), 812 bits, see alignment E=2.1e-248

Best Hits

Swiss-Prot: 70% identical to MTRB_SHEB8: Outer membrane protein MtrB (mtrB) from Shewanella baltica (strain OS185)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2527)

Predicted SEED Role

"outer membrane protein, MtrB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFZ5 at UniProt or InterPro

Protein Sequence (699 amino acids)

>Shew_2527 outer membrane protein precursor MtrB (RefSeq) (Shewanella loihica PV-4)
MKFKLNVVTLALIANAGIVIPGMALADGYGIQNANTEKVKFDNWACKRCKIETGVTGTIG
AGVGYNDSDDIRSANAFAAENEFVGKVDADVSYISESGYRASIEAQNLGMENGRLDLESG
KVGQHKLSLNYRQIATYKTDKAMSPYQGVGGDHLTLPDNWQTAGSSQDMSELYSSLNPLE
LSLKRKRAGIGFEYQGEELWSTYVNYQREDKTGLKQASGSFFNQSMMLAEPVDYTTDTVE
AGIKLKGDNWFTALAYSGSSFKNQYSQLTFDNAFNPTFGAQTQGTMALDPDNEAHTVSLM
GQYTAGSTIMSGRVHYGQMSQDQALVTSGYGYQTPVDALDAKVDMKGANLKVVSRINRTV
RVNASYDYSDRDNKTNVEEWTQISINSTTGKVAYNTPYDFTTQRAKLGADFRLSRGMKLE
AGYDFRRDERSYQDRETTDENTLWTKFHLSAFDNWDMWIKGSYGERDGSEYQASEWTSSE
SNSLLRKYNLADRQRTMVEARISHTPIEALTIDFGGLYALDDYNETQIGLTESKDVSYDI
NASYLINDDMMVNAFYNRQNIDSEQAGSSNYSTPNWFGLVEDQVDVIGAGFSYNNLLEKK
LRLGVDYTYSDSSSNTQVKQGLSGNYGDYYAKVHNVNVYGQYQATDNMALRLDYKMEKYK
DNDPGNSIAPDGIWNVVGFGYNSHDYNAHLIMLSMSYKL