Protein Info for Shew_2520 in Shewanella loihica PV-4

Annotation: outer membrane protein, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR03509: decaheme-associated outer membrane protein, MtrB/PioB family" amino acids 59 to 703 (645 residues), 593 bits, see alignment E=4.2e-182 PF11854: MtrB_PioB" amino acids 67 to 703 (637 residues), 644.7 bits, see alignment E=1.8e-197

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2520)

Predicted SEED Role

"outer membrane protein, MtrE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFY8 at UniProt or InterPro

Protein Sequence (703 amino acids)

>Shew_2520 outer membrane protein, putative (RefSeq) (Shewanella loihica PV-4)
MNRLKGTHTRAWSLSLLTLSILSSLASAQGYDLASANRSSVKMDAWKCQRCEVKDATTGE
IGVGVAYNDGGDSRFGNTTGTDTDGAVASLEADLTHKKASGYQTQFKADRLGYDAGSASL
TTGRKGQYEIAASYRGFARFDNNAALTPYRLTAASWQLPSQWQSAATTDQMSSLNDSLMA
SELKITRDRYRLDAAYTGSFYEASLGYQHEQRQGNRRASANLLTNSTMLAERVDDKSDRI
EGKLYFRGDQWLTGIDAELSHYKNDINALHWQSAFSPTFGAAYYGQSAVAPDNKAYRVAA
HSQFSASGQQVLMHLGFSRMTQDQAYLPATINGPSPMLPATNLDGQVDLLEMKLKYLGRL
TPELSLRAGYDYRDRDNKSEIMSYPQIITDSYYSGDKLNQAYDRTRQQANLGAKYRFTRS
LYLDLQYQYEHNNYNALDRDSLQTSDVTAKLHYRLSSQWQAWLKAEFEDRGGSKYLGSSV
SNRPNNPLLRRSYLADRERQRYGLYTSYNGEALSATLNLHLMQDDYTDTQIGLTQVDSQG
YDLSANYALNEQINLSAFVNQDWRDSDQAGSNNFGSANWFATTKDKATLIGAGFDYDALM
ENRLRLGLNYSYSDGQSDTEVSQGLHSPYGSYYATRHNLNAFADFNLSESLGLRLDWIFE
QYQDADWANGKLMPDSIPNVLTFGDLSHDYNAHYFGVTLSYQL