Protein Info for Shew_2519 in Shewanella loihica PV-4

Annotation: cytochrome C family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF13435: Cytochrome_C554" amino acids 31 to 101 (71 residues), 18.5 bits, see alignment E=1.1e-06 TIGR03508: decaheme c-type cytochrome, DmsE family" amino acids 59 to 316 (258 residues), 317.4 bits, see alignment E=7e-99 PF09699: Paired_CXXCH_1" amino acids 90 to 140 (51 residues), 21.4 bits, see alignment 5.7e-08 amino acids 197 to 237 (41 residues), 31.9 bits, see alignment 3.1e-11 amino acids 244 to 281 (38 residues), 44.6 bits, see alignment 3.2e-15 PF22678: Cytochrom_c_NrfB-like" amino acids 96 to 171 (76 residues), 51.7 bits, see alignment E=3.4e-17 TIGR01905: doubled CXXCH domain" amino acids 244 to 281 (38 residues), 37.3 bits, see alignment 2e-13

Best Hits

Swiss-Prot: 68% identical to MTRA_SHEB8: Multiheme cytochrome MtrA (mtrA) from Shewanella baltica (strain OS185)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2519)

Predicted SEED Role

"periplasmic decaheme cytochrome c, MtrD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFY7 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Shew_2519 cytochrome C family protein (RefSeq) (Shewanella loihica PV-4)
MMMKKESTWLRALRLTALLALYPLFSLLAQATPWDEMPADEVEKILDSKFAEGQYSPKGA
DSCLMCHRKNQTVMALFDGVHGNPQVKGSPMADLQCEACHGPMGKHNRGGKEPMITFGSN
SPVPAEKQNSVCMSCHNDDQRMGWSGNHHDNADVACSDCHQVHTGHDPISDKSQEVAVCT
TCHTQQKADLHKRSSHPLKWQQMVCSDCHNSHGGLGEASLKQMSINDNCYACHAEKRGPK
LWEHAPVTDNCANCHNPHGTVNEAMLIAKPPQLCQQCHASDGHAANPVFANSPNAFNGGQ
SCLNCHNQVHGSNHPSGKLLQR