Protein Info for Shew_2507 in Shewanella loihica PV-4

Name: clpX
Annotation: ATP-dependent protease ATP-binding subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 12 to 413 (402 residues), 692.9 bits, see alignment E=7.7e-213 PF06689: zf-C4_ClpX" amino acids 15 to 51 (37 residues), 70.8 bits, see alignment 3.1e-23 PF00493: MCM" amino acids 70 to 194 (125 residues), 23.7 bits, see alignment E=1.1e-08 PF01078: Mg_chelatase" amino acids 112 to 147 (36 residues), 20.5 bits, see alignment 1.2e-07 PF07724: AAA_2" amino acids 113 to 311 (199 residues), 117.6 bits, see alignment E=2.7e-37 PF07728: AAA_5" amino acids 115 to 192 (78 residues), 26.5 bits, see alignment E=2.6e-09 PF00004: AAA" amino acids 116 to 221 (106 residues), 57.9 bits, see alignment E=6.8e-19 PF10431: ClpB_D2-small" amino acids 318 to 395 (78 residues), 43.9 bits, see alignment E=9.1e-15

Best Hits

Swiss-Prot: 100% identical to CLPX_SHELP: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 100% identity to slo:Shew_2507)

MetaCyc: 81% identical to ATP-dependent Clp protease ATP-binding subunit ClpX (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFX5 at UniProt or InterPro

Protein Sequence (426 amino acids)

>Shew_2507 ATP-dependent protease ATP-binding subunit (RefSeq) (Shewanella loihica PV-4)
MGDNKSNGDSGKLLYCSFCGKSQHEVRKLIAGPSVYVCDECVELCNDIIREEIREISPKQ
DQDRLPTPHELRAHLDDYVIGQEKAKKVLSVAVYNHYKRLKNATPKDGVELGKSNILLIG
PTGSGKTLLAETLARFLNVPFTMADATTLTEAGYVGEDVENIIQKLLQKCDYDVEKAQRG
IVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVAAVPPQGGRKHPQQEFLQVD
TSKILFICGGAFAGLEKVIEQRSHVGTGIGFGAEVKGEADKATISDVLLQVEPEDLVKYG
LIPEFIGRLPVLATLAELDEAALIQILSEPKNALTKQFAALFEMEGVELEFREDALKAIA
LKAMDRKTGARGLRSIVEGILLDIMYDLPSTENVAKVVIDESVVKGESAPILIYEANETQ
AAVAEQ