Protein Info for Shew_2503 in Shewanella loihica PV-4

Annotation: trans-2-enoyl-CoA reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 PF12242: Eno-Rase_NADH_b" amino acids 2 to 80 (79 residues), 122.6 bits, see alignment E=6.5e-40 PF12241: Enoyl_reductase" amino acids 82 to 317 (236 residues), 369.3 bits, see alignment E=1.1e-114 PF07055: Eno-Rase_FAD_bd" amino acids 326 to 389 (64 residues), 105.7 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 100% identical to FABV_SHELP: Enoyl-[acyl-carrier-protein] reductase [NADH] (fabV) from Shewanella loihica (strain ATCC BAA-1088 / PV-4)

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2503)

Predicted SEED Role

"Short-chain alcohol dehydrogenase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFX1 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Shew_2503 trans-2-enoyl-CoA reductase (RefSeq) (Shewanella loihica PV-4)
MIIKPKTRGFICTTTHPVGCEANVLEQINITKAKGPVANGPKKVLVIGSSSGYGLSSRIA
AAFGSGAATLGVFFEKPGTETKPGTAGWYNSAAFDKFAKQGGLYSKSLNCDAFSHEAKQK
AIELIKQDLGQVDMVVYSLASPVRKLPDSGELIRSSLKPIGETYKSTAVDTNKDLIIETS
VEPATEQEIEDTVTVMGGQDWELWINALAEAGVLTPDCKTVAYSYIGTELTWPIYWHGAL
GKAKMDLDRAAHALNDKLSATGGSANVAVLKSVVTQASSAIPVMPLYIAMVFKKMREEGL
HEGCQEQINRMFHERLYRADGAAPAVDDANRLRLDDWELRDEIQQHCRDLWPTITTENLS
ELTDYREYKEEFLKLFGFGIESVDYDADVNPEVNFDVEQF