Protein Info for Shew_2501 in Shewanella loihica PV-4

Annotation: oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00005: ABC_tran" amino acids 23 to 186 (164 residues), 97.3 bits, see alignment E=1.3e-31 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 235 to 322 (88 residues), 65 bits, see alignment E=2.5e-22 PF08352: oligo_HPY" amino acids 237 to 304 (68 residues), 60.7 bits, see alignment E=1.4e-20

Best Hits

Swiss-Prot: 56% identical to SAPD_SALTY: Peptide transport system ATP-binding protein SapD (sapD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to slo:Shew_2501)

MetaCyc: 55% identical to putrescine ABC exporter ATP binding protein SapD (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFW9 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Shew_2501 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq) (Shewanella loihica PV-4)
MPLLDIRNLTIELDTPHGRVKALERVSLTLNPGEVHGLVGESGSGRTLLAKAILGIPGHN
WTIQADRMMWDGQNLMDMSPSERRVLMGSEMAMIFQDPISSLDPAIAVGTQIIEAMPENK
ELPWWKRGSDKRKKAQQWLHKVGIKETQKIMSSYAWELSDGECQKVMIAIAVANQPRLLI
ADEPTNSMEVRTQAQIFRLLSKLNQLQNVSILLISHELETLSQWCDRLTVMYSGQVMESG
VTSDVIANPYHPYTKALLDNIPDYSNPEHHKTMMQTLPGSAPALQHLPIGCRLGPRCPQA
QKLCVNQPSLCHQKDRYFACHFPYHNEPCHEEPLTKS