Protein Info for Shew_2497 in Shewanella loihica PV-4

Annotation: sigma-54 dependent trancsriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR02974: psp operon transcriptional activator" amino acids 10 to 351 (342 residues), 554.6 bits, see alignment E=4.2e-171 PF00158: Sigma54_activat" amino acids 10 to 173 (164 residues), 205.1 bits, see alignment E=1.8e-64 PF14532: Sigma54_activ_2" amino acids 11 to 181 (171 residues), 65.6 bits, see alignment E=1.8e-21 PF07728: AAA_5" amino acids 33 to 153 (121 residues), 31.8 bits, see alignment E=4e-11 PF01078: Mg_chelatase" amino acids 34 to 151 (118 residues), 22.6 bits, see alignment E=1.8e-08 PF25601: AAA_lid_14" amino acids 182 to 245 (64 residues), 64.7 bits, see alignment E=1.8e-21 PF02954: HTH_8" amino acids 317 to 351 (35 residues), 27.6 bits, see alignment 5.9e-10

Best Hits

KEGG orthology group: K03974, psp operon transcriptional activator (inferred from 100% identity to slo:Shew_2497)

Predicted SEED Role

"Psp operon transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFW5 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Shew_2497 sigma-54 dependent trancsriptional regulator (RefSeq) (Shewanella loihica PV-4)
MANQFQQDNLIGQSNALLEVLEHVSKIAPLSKPVLIIGERGTGKELIAERLHYLSKRWDQ
SFIKLNCSSLSENLLESELFGHDAGAFTGANKKHEGRFERADGGTLFLDELANTSGLIQE
KLLRVIEYGEFERVGGSKTVQTDVRLVCAANEDLPSLAEAGEFRADLLDRLAFDVITLPP
LRHRPEDIMPLAEYFAIGMARQLKQPQFDGFSRNAIDQLLDYHWPGNIRELKNVVERAVY
RNTDQEEPIDSIIIDPFASPYRPTNRVKTKSRQVQSEQAVEQESPATPATESASKANGLD
ISFPLDFKEHCEQQEILLLKKALESGQYNQKKTAELLGLSYHQLRGILKKYNLLDK