Protein Info for Shew_2491 in Shewanella loihica PV-4

Annotation: methionine gamma-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01328: methionine gamma-lyase
  • amino acids 7 to 389 (383 residues), 551 bits, E=7.1e-170
• PF01053: Cys_Met_Meta_PP
  • amino acids 8 to 389 (382 residues), 486.5 bits, E=8.5e-150
• PF00155: Aminotran_1_2
  • amino acids 59 to 191 (133 residues), 25.5 bits, E=1.5e-09
• PF01041: DegT_DnrJ_EryC1
  • amino acids 61 to 182 (122 residues), 29.2 bits, E=1.1e-10

Best Hits

Swiss-Prot: 54% identical to MEGL_FUSNP: L-methionine gamma-lyase (mgl) from Fusobacterium nucleatum subsp. polymorphum

KEGG orthology group: K01761, methionine-gamma-lyase [EC: 4.4.1.11] (inferred from 100% identity to slo:Shew_2491)

MetaCyc: 50% identical to MdeA (Pseudomonas putida)
Methionine gamma-lyase. [EC: 4.4.1.11]

Predicted SEED Role

"Methionine gamma-lyase (EC 4.4.1.11)" in subsystem Methionine Degradation (EC 4.4.1.11)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-threonine metabolism (15/18 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• L-threonine degradation I (6/6 steps found)
• L-methionine degradation II (3/3 steps found)
• seleno-amino acid detoxification and volatilization III (2/3 steps found)
• dimethyl sulfide biosynthesis from methionine (1/2 steps found)
• seleno-amino acid detoxification and volatilization I (1/2 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.11

Sequence Analysis Tools

See A3QFV9 at UniProt or InterPro

Protein Sequence (391 amino acids)

>Shew_2491 methionine gamma-lyase (RefSeq) (Shewanella loihica PV-4)
MQDKWKLATQVIHAGHEANQHGALVSPLVQSATFTFETVEQGGDCFAGEQQGYIYTRLGN
PTTAELERKMAVLEGSEAAAATASGMAAVSAALLTNLSQGDHLVASKAVYGCTFALMTEQ
FKRFGIEVTLVDFCEVANIAQAIRPNTKALFCETPVNPHLDVYDLAAIAALAKRHQLVSI
VDNTFMTPLLQRPLSMGIDMVIHSATKYLNGHGDVIAGIVCGTEEMITKVKLEVLKDIGG
VISPHDAWLILRGLKTLDVRLARHCDNAERVAEYLQQHPQVARVYYPGLKGHSGHALLGK
QMLRAGGVVAFELKGSFDAAKAFANRLKLFKIAVSLGDAESLIQHPASMTHSPYSPEARM
DAGIGDSLLRISLGLEDSDDIIADLAQAFGE