Protein Info for Shew_2464 in Shewanella loihica PV-4

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details PF01925: TauE" amino acids 13 to 248 (236 residues), 168.7 bits, see alignment E=8.9e-54

Best Hits

Swiss-Prot: 57% identical to YFCA_ECOL6: Probable membrane transporter protein YfcA (yfcA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07090, (no description) (inferred from 100% identity to slo:Shew_2464)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFT2 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Shew_2464 hypothetical protein (RefSeq) (Shewanella loihica PV-4)
MSLELSYELMALLFAVAALAGFIDAIAGGGGLITIPALMWAGLPPTAALATNKLQACGGS
FFASFYFVRKGMVDLSKMKLAICCAFLGAALGTVAVQLIDASVLKLLLPFLILAIGCYFL
FSKSISEEDKHQVMSPTLFGLTAALGVGFYDGFFGPGTGSFFALAFVSLAGYGLAKATAH
AKVLNFSTNIASLIFFALGGKVFWLLGGVMLLGQAIGATLGSRMVVTKGSKIIRPLVVTM
SIAMSGKLLLEHYL