Protein Info for Shew_2461 in Shewanella loihica PV-4

Annotation: MORN repeat-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF07661: MORN_2" amino acids 106 to 125 (20 residues), 11.2 bits, see alignment (E = 1.9e-05) amino acids 156 to 172 (17 residues), 10 bits, see alignment (E = 5.1e-05) amino acids 175 to 196 (22 residues), 17.4 bits, see alignment (E = 2e-07) amino acids 248 to 268 (21 residues), 18.1 bits, see alignment (E = 1.1e-07) amino acids 322 to 341 (20 residues), 11.4 bits, see alignment (E = 1.7e-05) amino acids 352 to 372 (21 residues), 11.7 bits, see alignment (E = 1.4e-05) amino acids 399 to 420 (22 residues), 16.1 bits, see alignment (E = 5.1e-07) amino acids 448 to 467 (20 residues), 15 bits, see alignment (E = 1.2e-06) amino acids 479 to 500 (22 residues), 11.4 bits, see alignment (E = 1.7e-05) amino acids 657 to 678 (22 residues), 20.4 bits, see alignment (E = 2.1e-08) amino acids 729 to 749 (21 residues), 15.4 bits, see alignment (E = 8.3e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2461)

Predicted SEED Role

"FIG01057005: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFS9 at UniProt or InterPro

Protein Sequence (772 amino acids)

>Shew_2461 MORN repeat-containing protein (RefSeq) (Shewanella loihica PV-4)
MHSNRAYSVLLAGFGLGVSSFIASPVAASQNLSSLMVEIRQQEGIATYYNLATGMALSGQ
VTLVRDNQGYTLGEFAQGVPNGRWQVYLPNNQKLVDGEYVSGLQSGRWQLFSPNGELSEE
QFYLNGVPSGEWAEYDDLGNLYQKTVYEAGVKTQVLRYFASGKLKAKETYVDNLRHGVWE
TYHANGVLAQSQQYANNQLSGPSLAQNSEGQVIETGTLDANGERQGRWQTFYDDGTPERD
EHYVAGRLHGESLSYYPNGQLSLQGQYREDLRQGTLVHYSDTGVKLEEENYLDGEHDGIQ
RYFNRAGILVSELNYKAGLQAGEQKTYFDDGKPKKVIRYQDQILADNGQYPLHGLQQRFD
PAGNLLATEHYDMGLKDGKFETYRQGKLQRQEQWRQGARHGDFIAYYDNGQLRSLDQYQD
NRQTGKAERYFDDGTLKERGTRIDGQWVGKYESFYETGKPRELIHYSDEKIAGRSRYPLH
GAFSRWYANGDLNEAGEYKDGEKQGTWRQYRQGIVSREMTFEAGKLNGPYSEFDNGRRRV
TGHYLEDRKEGEWTEYRYQEKDPSFGPIPEGNIYRVSHYRQDKLEGERAYYSFKQVRYRS
EQYQAGELSGHYSEYYANNGQLKREGEMLKGEQVGLWQSWFEDGVLSESGEYLAGKLNGE
YAKYYPNGQLKVRAHYQNDKLSGEQLSYFQTGKPQAKEQWLDGQREGEASYFHANGKQAE
QGAFLRSRKEGLWRAYWPSGELRSEGSYIADRQAGDWAFYDQFGKLIKTEHH