Protein Info for Shew_2409 in Shewanella loihica PV-4

Annotation: short chain dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF23441: SDR" amino acids 11 to 203 (193 residues), 32.8 bits, see alignment E=1.2e-11 PF00106: adh_short" amino acids 14 to 210 (197 residues), 167.8 bits, see alignment E=5.1e-53 PF08659: KR" amino acids 15 to 198 (184 residues), 43.5 bits, see alignment E=8.4e-15 PF13561: adh_short_C2" amino acids 20 to 242 (223 residues), 136.2 bits, see alignment E=3.5e-43 PF08643: DUF1776" amino acids 94 to 197 (104 residues), 26.5 bits, see alignment E=1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to slo:Shew_2409)

MetaCyc: 65% identical to CAI-1 synthase (Vibrio cholerae O1 biovar El Tor str. N16961)
1.1.1.-

Predicted SEED Role

"FIG00553873: hypothetical protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A3QFM7 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Shew_2409 short chain dehydrogenase (RefSeq) (Shewanella loihica PV-4)
MLEYQAAKDLLKDKTILVTGAGDGIGRAAALAYAEHGATVILLGKTVKKLEAVYDEIEQA
GYPTPAIVPLDLKGATEQNYQDMAETIEQQFGHLDGLLHNASLLGVLGPFEHISMDSVKE
VLQVNLVAEIMMTKALLPVMKKAPAASILFTSSSVGRQGRAFWGEYAISKFATEGMMQSL
AHEYEDSNLRVNSINPGATRTKMRANAYPAENPQDLKAPEEIMATYLYLMGDDAKGVTGQ
QFNAQ